PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016649071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 226aa    MW: 26013.6 Da    PI: 8.6973
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016649071.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.1e-33147205159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
  XP_016649071.1 147 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYQGCNVKKQVQRLTQDEGIVVTTYEGMHTHP 205
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-34132205IPR003657WRKY domain
SuperFamilySSF1182907.59E-30139206IPR003657WRKY domain
PROSITE profilePS5081129.987142207IPR003657WRKY domain
SMARTSM007741.1E-39147206IPR003657WRKY domain
PfamPF031068.5E-27148205IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEKYQMFFPC SSSTSSANYD PMIPISATNN ITTDDHHMGM GSSQVYNYFD GRDQSSNGLL  60
ALXDNQKETT LGERREVLIN KDHHRYLQQQ YSDPTTTASA NININNVVVG ADQNPHEATN  120
SGNKNKGEKK TRKPKYAFQT RSQVDILDDG YRWRKYGQKA VKNNKFPRSY YRCTYQGCNV  180
KKQVQRLTQD EGIVVTTYEG MHTHPIEKPS DNFEHILNQM QIYTPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-27137206776Probable WRKY transcription factor 4
2lex_A3e-27137206776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007216937.11e-155hypothetical protein PRUPE_ppa016459mg
TrEMBLM5WY441e-155M5WY44_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s33560.18e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-57WRKY DNA-binding protein 75